Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PTDSS1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | PTDSS1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15996620
![]() |
Novus Biologicals
NBP15996620UL |
20 μL |
Each for $206.00
|
|
|||||
NBP159966
![]() |
Novus Biologicals
NBP159966 |
100 μL |
Each for $487.50
|
|
|||||
Description
PTDSS1 Polyclonal specifically detects PTDSS1 in Human samples. It is validated for Western Blot.Specifications
PTDSS1 | |
Polyclonal | |
Rabbit | |
P48651 | |
9791 | |
Synthetic peptides corresponding to PTDSS1(phosphatidylserine synthase 1) The peptide sequence was selected from the N terminal of PTDSS1. Peptide sequence MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITIDFFYRPHTITLLSFTI. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
KIAA0024Serine-exchange enzyme I, phosphatidylserine synthase 1, PSS1EC 2.7.8.-, PSSAPSS-1, PtdSer synthase 1 | |
PTDSS1 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title