Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PTEN2/TPTE Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP158242
Description
PTEN2/TPTE Polyclonal specifically detects PTEN2/TPTE in Human samples. It is validated for Western Blot.Specifications
PTEN2/TPTE | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
Cancer/testis antigen 44, EC 3.1.3.48, PTEN2, putative tyrosine-protein phosphatase TPTE, tensin, putative protein-tyrosine phosphatase, transmembrane phosphatase with tensin homologytensin, putative protein-tyrosine phosphatase, EC 3.1.3.4810CT44PTEN-related tyrosine phosphatase, Tumor antigen BJ-HCC-5 | |
Rabbit | |
Protein A purified | |
RUO | |
7179 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Western Blot | |
1 mg/ml | |
Western Blot 1.0 ug/ml | |
P56180-2 | |
TPTE | |
Synthetic peptides corresponding to TPTE (transmembrane phosphatase with tensin homology) The peptide sequence was selected from the C terminal of TPTE. Peptide sequence MNESPDPTDLAGVIIELGPNDSPQTSEFKGATEEAPAKESVLARLSKFEV. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Human: 100%. | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction