PTGER3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Catalog Number	Mfr. No.	Quantity
NB432466	Novus Biologicals NBP18483525UL	25ul
NBP184835	Novus Biologicals NBP184835	0.1 mL

Description

PTGER3 Polyclonal specifically detects PTGER3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PTGER3
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: EP3EP3e, EP3-I, EP3-II, EP3-III, EP3-IV, MGC141828, MGC141829, MGC27302, PGE receptor EP3 subtype, PGE receptor, EP3 subtype, PGE2 receptor EP3 subtype, PGE2-R, prostaglandin E receotor EP3 subtype 3 isoform, prostaglandin E receptor 3 (subtype EP3), prostaglandin E2 receptor EP3 subtype, prostaglandin receptor (PGE-2), Prostanoid EP3 receptor
• Gene Symbols: PTGER3
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Cancer, GPCR, Signal Transduction
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 5733
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVS
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only