PTGER3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP18483525UL

Catalog No. NB432466

Description

PTGER3 Polyclonal specifically detects PTGER3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PTGER3
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: EP3EP3e, EP3-I, EP3-II, EP3-III, EP3-IV, MGC141828, MGC141829, MGC27302, PGE receptor EP3 subtype, PGE receptor, EP3 subtype, PGE2 receptor EP3 subtype, PGE2-R, prostaglandin E receotor EP3 subtype 3 isoform, prostaglandin E receptor 3 (subtype EP3), prostaglandin E2 receptor EP3 subtype, prostaglandin receptor (PGE-2), Prostanoid EP3 receptor
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PTGER3
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVS
• Quantity: 25ul
• Research Discipline: Cancer, GPCR, Signal Transduction
• Gene ID (Entrez): 5733
• Target Species: Human
• Isotype: IgG

For Research Use Only