Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PTH1R/PTHR1 Antibody, Novus Biologicals™

PTH1R/PTHR1 Antibody, Novus Biologicals™
SDP

Catalog No. NB406181 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB406181 25 μL
NBP187192 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB406181 Supplier Novus Biologicals Supplier No. NBP18719225UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

PTH1R/PTHR1 Polyclonal specifically detects PTH1R/PTHR1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen PTH1R/PTHR1
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q03431
Gene Alias MGC138426, parathyroid hormone 1 receptorMGC138452, parathyroid hormone/parathyroid hormone-related peptide receptor, parathyroid hormone/parathyroid hormone-related protein receptor, PFE, PTH/PTHr receptor, PTH/PTHrP type I receptor, PTH1 receptor, PTHRPTHR1parathyroid hormone receptor 1, seven transmembrane helix receptor
Gene Symbols PTH1R
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RWTLALDFKRKARSGSSSYSYGPMVSHTSVTNVGPRVGLGLPLSPRLLPTATTNGHPQLPGHAKPGTPALETLETTPPAMAAPKDDGFLNGSCSGLDEEASGPERPPALLQ
Molecular Weight of Antigen 66 kDa
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline GPCR, Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 5745
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.