PTOP Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP309631100UL

Catalog No. NB124163

Description

PTOP Polyclonal specifically detects PTOP in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: PTOP
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: ALS2CR7, amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 7, Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 7 protein, Cell division protein kinase 15, cyclin-dependent kinase 15, EC 2.7.11, EC 2.7.11.22, PFTAIRE protein kinase 2, PFTK2, Serine/threonine-protein kinase ALS2CR7, Serine/threonine-protein kinase PFTAIRE-2
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse PTOP (NP_001028545). Peptide sequence ASFHPRGLEAASAQKLKSKRPRSNSDSFQEENLRQGLPWKKSLPFGAASS
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Mouse
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 65061
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.