Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PTOP Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | PTOP |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
PTOP Polyclonal specifically detects PTOP in Mouse samples. It is validated for Western Blot.Specifications
| PTOP | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Mouse | |
| ALS2CR7, amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 7, Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 7 protein, Cell division protein kinase 15, cyclin-dependent kinase 15, EC 2.7.11, EC 2.7.11.22, PFTAIRE protein kinase 2, PFTK2, Serine/threonine-protein kinase ALS2CR7, Serine/threonine-protein kinase PFTAIRE-2 | |
| The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse PTOP (NP_001028545). Peptide sequence ASFHPRGLEAASAQKLKSKRPRSNSDSFQEENLRQGLPWKKSLPFGAASS | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 65061 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title