Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PTP alpha/PTPRA Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25725525UL
Description
PTP alpha/PTPRA Polyclonal specifically detects PTP alpha/PTPRA in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
PTP alpha/PTPRA | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
EC 3.1.3.48, HEPTP, LRPHPTPalpha, protein tyrosine phosphatase, receptor type, A, Protein-tyrosine phosphatase alpha, PTPAreceptor type, alpha polypeptide, PTPLCA-related phosphatase, receptor-type tyrosine-protein phosphatase alpha, RPTPA, R-PTP-alpha, tyrosine phosphatase alpha | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
IgG |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
PTPRA | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EPVKEEAKTSNPTSSLTSLSVAPTFSPNITLGPTYLTTVNSSDSDNGTTRTASTNSIGITISPNGTWLPDNQFTDARTEPWEGNSSTAATTPETFPP | |
25 μL | |
GPCR, Protein Phosphatase, Signal Transduction | |
5786 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction