Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PTP alpha/PTPRA Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | PTP alpha/PTPRA |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PTP alpha/PTPRA Polyclonal specifically detects PTP alpha/PTPRA in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
PTP alpha/PTPRA | |
Polyclonal | |
Rabbit | |
GPCR, Protein Phosphatase, Signal Transduction | |
EC 3.1.3.48, HEPTP, LRPHPTPalpha, protein tyrosine phosphatase, receptor type, A, Protein-tyrosine phosphatase alpha, PTPAreceptor type, alpha polypeptide, PTPLCA-related phosphatase, receptor-type tyrosine-protein phosphatase alpha, RPTPA, R-PTP-alpha, tyrosine phosphatase alpha | |
PTPRA | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
5786 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EPVKEEAKTSNPTSSLTSLSVAPTFSPNITLGPTYLTTVNSSDSDNGTTRTASTNSIGITISPNGTWLPDNQFTDARTEPWEGNSSTAATTPETFPP | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title