Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PTPIP51 Antibody, Novus Biologicals™

PTPIP51 Antibody, Novus Biologicals™
SDP

Catalog No. NBP16247420 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16247420 20 μL
NBP162474 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP16247420 Supplier Novus Biologicals Supplier No. NBP16247420UL

Description

Rabbit Polyclonal Antibody

PTPIP51 Polyclonal specifically detects PTPIP51 in Human samples. It is validated for Western Blot.

Specifications

Antigen PTPIP51
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q96TC7
Gene Alias Cerebral protein 10, FAM82Cmicrotubule-associated protein, family with sequence similarity 82, member A2, FLJ10579, hRMD-3, Protein FAM82A2, Protein FAM82C, Protein tyrosine phosphatase-interacting protein 51, ptpip51, PTPIP51family with sequence similarity 82, member C, regulator of microtubule dynamics 3, regulator of microtubule dynamics protein 3, RMD3, RMD-3, TCPTP-interacting protein 51
Gene Symbols FAM82A2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to PTPIP51 The peptide sequence was selected from the middle region of PTPIP51. Peptide sequence LSATVEDALQSFLKAEELQPGFSKAGRVYISKCYRELGKNSEARWWMKLA.
Molecular Weight of Antigen 52 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55177
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.