Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PTPIP51 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $329.00

Specifications

Antigen PTPIP51
Immunogen Synthetic peptides corresponding to PTPIP51 The peptide sequence was selected from the middle region of PTPIP51. Peptide sequence LSATVEDALQSFLKAEELQPGFSKAGRVYISKCYRELGKNSEARWWMKLA.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP16247420 View Documents Novus BiologicalsSupplier Diversity Partner
NBP16247420UL
20ul Each for $149.00
Add to cart
 
NBP162474 View Documents Novus BiologicalsSupplier Diversity Partner
NBP162474
100 ul Each for $329.00
Add to cart
 
Description

Description

PTPIP51 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

PTPIP51
Rabbit
Polyclonal
Unconjugated
55177
Affinity Purified
Western Blot
RUO
Synthetic peptides corresponding to PTPIP51 The peptide sequence was selected from the middle region of PTPIP51. Peptide sequence LSATVEDALQSFLKAEELQPGFSKAGRVYISKCYRELGKNSEARWWMKLA.
Primary
IgG
Cerebral protein 10, FAM82Cmicrotubule-associated protein, family with sequence similarity 82, member A2, FLJ10579, hRMD-3, Protein FAM82A2, Protein FAM82C, Protein tyrosine phosphatase-interacting protein 51, ptpip51, PTPIP51family with sequence similarity 82, member C, regulator of microtubule dynamics 3, regulator of microtubule dynamics protein 3, RMD3, RMD-3, TCPTP-interacting protein 51
PBS and 2% Sucrose with 0.09% Sodium Azide
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit