PTPN14/PTPD2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238712

Catalog No. NBP238712

Description

PTPN14/PTPD2 Polyclonal specifically detects PTPN14/PTPD2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PTPN14/PTPD2
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL
• Gene Accession No.: Q15678
• Gene Symbols: PTPN14
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PMLREKMEYSAQLQAALARIPNKPPPEYPGPRKSVSNGALRQDQASLPPAMARARVLRHGPAKAISMSRTD
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 3.1.3, EC 3.1.3.48, MGC126803, PEZcytoskeletal-associated protein tyrosine phosphatase, protein tyrosine phosphatase, non-receptor type 14, Protein-tyrosine phosphatase pez, PTP36, tyrosine-protein phosphatase non-receptor type 14
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5784
• Target Species: Human
• Isotype: IgG