Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PTPRN2 Antibody, Novus Biologicals™

PTPRN2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP181628 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP181628 0.1 mL
NB433786 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP181628 Supplier Novus Biologicals Supplier No. NBP181628
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

PTPRN2 Polyclonal specifically detects PTPRN2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen PTPRN2
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias EC 3.1.3.48, IA-2beta, IAR/receptor-like protein-tyrosine phosphatase, ICAARIARPTPRP, Islet cell autoantigen-related protein, KIAA0387, phogrin, protein tyrosine phosphatase receptor pi, protein tyrosine phosphatase, receptor type, N polypeptide 2, receptor-type tyrosine-protein phosphatase N2, R-PTP-N2, tyrosine phosphatase IA-2 beta
Gene Symbols PTPRN2
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:QDDDDRLYQEVHRLSATLGGLLQDHGSRLLPGALPFARPLDMERKKSEHPESSLSSEEETAGVENVKSQTYSKDLLGQQPHSEPGAAAFGELQNQMPGPSKEEQSLPAGAQ
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Lipid and Metabolism, Protein Phosphatase
Primary or Secondary Primary
Gene ID (Entrez) 5799
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.