Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PUF60 Antibody, Novus Biologicals™

PUF60 Antibody, Novus Biologicals™
SDP

Catalog No. NB395884 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB395884 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB395884 Supplier Novus Biologicals Supplier No. NBP24903225UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

PUF60 Polyclonal antibody specifically detects PUF60 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen PUF60
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2), 40% Glycerol
Gene Alias FBP interacting repressor, FBP-interacting repressor, FIRpoly-U binding splicing factor PUF60, FLJ31379, FUSE-binding protein-interacting repressor, poly(U)-binding-splicing factor PUF60, poly-U binding splicing factor 60KDa, Ro ribonucleoprotein binding protein 1, Ro ribonucleoprotein-binding protein 1, Ro-binding protein 1, roBP1, ROBPI, siah binding protein 1,60 kDa poly(U)-binding-splicing factor, Siah-binding protein 1, siah-BP1, SIAHBP1pyrimidine tract binding splicing factor
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: AATAKITAQEAVAGAAVLGTLGTPGLVSPALTLAQPLGTLPQAVMAAQAPGVITGVTPARPPIPVTIPSVGVVNPILASPPTL
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 22827
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.