Learn More
Puromycin-sensitive aminopeptidase/NPEPPS Antibody, Novus Biologicals™
Shop All R&D Systems Products

Description
Specifications
Specifications
| Antigen | Puromycin-sensitive aminopeptidase/NPEPPS |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | AAP-S, aminopeptidase puromycin sensitive, Cytosol alanyl aminopeptidase, EC 3.4.11.2, EC 3.4.11.3, metalloproteinase MP100, MP100EC 3.4.11, PSAEC 3.4.11.14, puromycin-sensitive aminopeptidase |
| Gene Symbols | NPEPPS |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: TLEEARRRFKDHVEGKQILSADLRSPVYLTVLKHGDGTTLDIMLKLHKQADMQEEKNRIERVLGATLLPDLIQKVLTFALSE |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.