Puromycin-sensitive aminopeptidase/NPEPPS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP213670

Catalog No. NBP213670

Description

Puromycin-sensitive aminopeptidase/NPEPPS Polyclonal specifically detects Puromycin-sensitive aminopeptidase/NPEPPS in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Puromycin-sensitive aminopeptidase/NPEPPS
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: AAP-S, aminopeptidase puromycin sensitive, Cytosol alanyl aminopeptidase, EC 3.4.11.2, EC 3.4.11.3, metalloproteinase MP100, MP100EC 3.4.11, PSAEC 3.4.11.14, puromycin-sensitive aminopeptidase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9520
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: NPEPPS
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: VMNCADIDIITASYAPEGDEEIHATGFNYQNEDEKVTLSFPSTLQTGTGTLKIDFVGELNDKMKGFYRSKYTTPSGEVRYAAVTQFEA
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only