PUS10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156369

Catalog No. NBP156369

Description

PUS10 Polyclonal specifically detects PUS10 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PUS10
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q3MIT2
• Gene Symbols: PUS10
• Immunogen: Synthetic peptides corresponding to PUS10 (pseudouridylate synthase 10) The peptide sequence was selected from the middle region of PUS10. Peptide sequence AVFVAGRYNKYSRNLPQTPWIIDGERKLESSVEELISDHLLAVFKAESFN.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Chicken: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Guinea pig: 92%; Zebrafish: 85%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CCDC139, coiled-coil domain containing 139, Coiled-coil domain-containing protein 139, DOBIMGC126729, EC 5.4.99, EC 5.4.99.-, FLJ32312, MGC126755, pseudouridine synthase 10, pseudouridylate synthase 10, Psi55 synthase, PUS1, putative tRNA pseudouridine synthase Pus10, tRNA pseudouridine 55 synthase, tRNA pseudouridylate synthase, tRNA-uridine isomerase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 150962
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.