PWP2H Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP152844

Catalog No. NBP152844

Description

PWP2H Polyclonal specifically detects PWP2H in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PWP2H
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: periodic tryptophan protein 2 homolog, PWP2 (periodic tryptophan protein, yeast) homolog, PWP2 periodic tryptophan protein homolog (yeast), PWP2HEHOC-17
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Chicken: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q15269
• Gene Symbols: PWP2
• Immunogen: Synthetic peptides corresponding to PWP2(PWP2 periodic tryptophan protein homolog (yeast)) The peptide sequence was selected from the middle region of PWP2. Peptide sequence VQTGSIEGRHDLKTGRKELDKITAKHAAKGKAFTALCYSADGHSILAGGM.
• Quantity: 100 μL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 5822
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.