Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PYCR1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15793420UL
Description
PYCR1 Polyclonal specifically detects PYCR1 in Human samples. It is validated for Western Blot.Specifications
PYCR1 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
A6NFM2 | |
PYCR1 | |
Synthetic peptides corresponding to PYCR1(pyrroline-5-carboxylate reductase 1) The peptide sequence was selected from the middle region of PYCR1. Peptide sequence RSLLINAVEASCIRTRELQSMADQEQVSPAAIKKTILDKDHLPLELGSPE. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
ARCL2B, EC 1.5.1.2, mitochondrial pyrroline-5-carboxylate reductase 1, P5C, P5C reductase 1, P5CR, P5CR 1, PIG45, PP222, PRO3, proliferation-inducing protein 45, PYCR, pyrroline-5-carboxylate reductase 1, pyrroline-5-carboxylate reductase 1, mitochondrial | |
Rabbit | |
Affinity Purified | |
RUO | |
5831 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction