Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PYCR1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | PYCR1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15793420
|
Novus Biologicals
NBP15793420UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP157934
|
Novus Biologicals
NBP157934 |
100 μL |
Each for $487.50
|
|
|||||
Description
PYCR1 Polyclonal specifically detects PYCR1 in Human samples. It is validated for Western Blot.Specifications
| PYCR1 | |
| Polyclonal | |
| Rabbit | |
| A6NFM2 | |
| 5831 | |
| Synthetic peptides corresponding to PYCR1(pyrroline-5-carboxylate reductase 1) The peptide sequence was selected from the middle region of PYCR1. Peptide sequence RSLLINAVEASCIRTRELQSMADQEQVSPAAIKKTILDKDHLPLELGSPE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ARCL2B, EC 1.5.1.2, mitochondrial pyrroline-5-carboxylate reductase 1, P5C, P5C reductase 1, P5CR, P5CR 1, PIG45, PP222, PRO3, proliferation-inducing protein 45, PYCR, pyrroline-5-carboxylate reductase 1, pyrroline-5-carboxylate reductase 1, mitochondrial | |
| PYCR1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title