Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PYHIN1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP179436 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP179436 100 μL
NBP17943620 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP179436 Supplier Novus Biologicals Supplier No. NBP179436
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

PYHIN1 Polyclonal specifically detects PYHIN1 in Human samples. It is validated for Western Blot.

Specifications

Antigen PYHIN1
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_945148
Gene Alias IFIXMGC23885, Interferon-inducible protein X, pyrin and HIN domain family, member 1, pyrin and HIN domain-containing protein 1, RP11-520H16.1
Gene Symbols PYHIN1
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human PYHIN1The immunogen for this antibody is PYHIN1. Peptide sequence KMKEEYDKIQIADLMEEKFPGDAGLGKLIEFFKEIPTLGDLAETLKREKL.
Molecular Weight of Antigen 51 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 149628
Test Specificity Expected identity based on immunogen sequence: Human: 100%; Sumatran orangutan: 78%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.