Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PYHIN1 Antibody, Novus Biologicals™

PYHIN1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP17943620 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP17943620 20 μL
NBP179436 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP17943620 Supplier Novus Biologicals Supplier No. NBP17943620UL

Description

Rabbit Polyclonal Antibody

PYHIN1 Polyclonal specifically detects PYHIN1 in Human samples. It is validated for Western Blot.

Specifications

Antigen PYHIN1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_945148
Gene Alias IFIXMGC23885, Interferon-inducible protein X, pyrin and HIN domain family, member 1, pyrin and HIN domain-containing protein 1, RP11-520H16.1
Gene Symbols PYHIN1
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human PYHIN1The immunogen for this antibody is PYHIN1. Peptide sequence KMKEEYDKIQIADLMEEKFPGDAGLGKLIEFFKEIPTLGDLAETLKREKL.
Molecular Weight of Antigen 51 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 149628
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.