PYK2/FAK2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP191228

Catalog No. NBP191228

Description

PYK2/FAK2 Polyclonal specifically detects PYK2/FAK2 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PYK2/FAK2
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: CADTKCAK-beta, CAK beta, CAKB, Calcium-dependent tyrosine kinase, Cell adhesion kinase beta, EC 2.7.10, FADK2, FAK2EC 2.7.10.2, Focal adhesion kinase 2, PKB, Proline-rich tyrosine kinase 2, protein kinase B, protein tyrosine kinase 2 beta, protein-tyrosine kinase 2-beta, PTK, PTK2B protein tyrosine kinase 2 beta, PYK2Related adhesion focal tyrosine kinase, RAFTKFADK 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PTK2B
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:TLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMREEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPM
• Quantity: 0.1 mL
• Research Discipline: Angiogenesis, Apoptosis, Cancer, Cellular Markers, Protein Kinase, Signal Transduction, Tyrosine Kinases
• Gene ID (Entrez): 2185
• Target Species: Human, Rat
• Isotype: IgG

For Research Use Only