Pyruvate Dehydrogenase E1 beta subunit Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238327

Catalog No. NBP238327

Description

Pyruvate Dehydrogenase E1 beta subunit Polyclonal specifically detects Pyruvate Dehydrogenase E1 beta subunit in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Pyruvate Dehydrogenase E1 beta subunit
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/ml, Simple Western reported by internal validation, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: P11177
• Gene Symbols: PDHB
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LIKSAIRDNNPVVVLENELMYGVPFEFPPEAQSKDFLIPIGKAKIERQGTHITVVSHSRPVGHCLEAAAVLSKEGVE
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: DKFZp564K0164, mitochondrial, pyruvate dehydrogenase (lipoamide) beta, pyruvate dehydrogenase, E1 beta polypeptide
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5162
• Target Species: Human
• Isotype: IgG