Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Pyruvate Dehydrogenase E1 beta subunit Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$254.42 - $666.47
Specifications
| Antigen | Pyruvate Dehydrogenase E1 beta subunit |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Pyruvate Dehydrogenase E1 beta subunit Polyclonal specifically detects Pyruvate Dehydrogenase E1 beta subunit in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Pyruvate Dehydrogenase E1 beta subunit | |
| Polyclonal | |
| Rabbit | |
| Human | |
| P11177 | |
| 5162 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LIKSAIRDNNPVVVLENELMYGVPFEFPPEAQSKDFLIPIGKAKIERQGTHITVVSHSRPVGHCLEAAAVLSKEGVE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| DKFZp564K0164, mitochondrial, pyruvate dehydrogenase (lipoamide) beta, pyruvate dehydrogenase, E1 beta polypeptide | |
| PDHB | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title