Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Supplier:  Novus Biologicals NBP18595525UL

Catalog No. NB406330

Description

Pyruvate Dehydrogenase Kinase 1/PDK1 Polyclonal specifically detects Pyruvate Dehydrogenase Kinase 1/PDK1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Pyruvate Dehydrogenase Kinase 1/PDK1
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50-1:200
• Gene Accession No.: Q15118
• Gene Symbols: PDK1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:KEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHND
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 2.7.11, EC 2.7.11.2, mitochondrial pyruvate dehydrogenase, lipoamide, kinase isoenzyme 1, PDH kinase 1, PDK1, PDK-1, PKB kinase, Pyruvate dehydrogenase kinase isoform 1, pyruvate dehydrogenase kinase, isoenzyme 1, pyruvate dehydrogenase kinase, isozyme 1, Pyruvate dehydrogenase lipoamide kinase isozyme 1, mitochondrial
• Host Species: Rabbit
• Molecular Weight of Antigen: 49 kDa
• Quantity: 25 μL
• Research Discipline: Autophagy, Cancer, Cytoskeleton Markers, Hypoxia, Lipid and Metabolism, mTOR Pathway, Protein Kinase, Signal Transduction
• Gene ID (Entrez): 5163
• Target Species: Human
• Isotype: IgG

For Research Use Only