Rab11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158933

Catalog No. NBP158933

Description

Rab11 Polyclonal antibody specifically detects Rab11 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Rab11
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: GTP-binding protein YPT3, H-YPT3, MGC133246, RAB11B, member of RAS oncogene family, RAB11B, member RAS oncogene family, ras-related protein Rab-11B, YPT3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Goat: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Xenopus: 92%; Chicken: 92%; Zebrafish: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Goat, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q15907
• Gene Symbols: RAB11B
• Immunogen: Synthetic peptides corresponding to RAB11B(RAB11B, member RAS oncogene family) The peptide sequence was selected from the C terminal of RAB11B. Peptide sequence IETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPGNNVVDISV.
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 9230
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only