Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RAB11FIP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15700920UL
Description
RAB11FIP2 Polyclonal specifically detects RAB11FIP2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
RAB11FIP2 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q7L804 | |
RAB11FIP2 | |
Synthetic peptides corresponding to RAB11FIP2 (RAB11 family interacting protein 2 (class I)) The peptide sequence was selected from the N terminal of RAB11FIP2. Peptide sequence LLIQGSPEKYILFLIVMHRSLVGLDKFLGQVAINLNDIFEDKQRRKTEWF. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
KIAA0941RAB11-FIP2 long isoform, nRip11, RAB11 family interacting protein 2 (class I), rab11 family-interacting protein 2, Rab11-FIP2NRip11 | |
Rabbit | |
Affinity Purified | |
RUO | |
22841 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction