Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. RAB11FIP2 Antibody, Novus Biologicals™

RAB11FIP2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15700920 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15700920 20 μL
NBP157009 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15700920 Supplier Novus Biologicals Supplier No. NBP15700920UL

Description

Rabbit Polyclonal Antibody

RAB11FIP2 Polyclonal specifically detects RAB11FIP2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

Antigen RAB11FIP2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q7L804
Gene Alias KIAA0941RAB11-FIP2 long isoform, nRip11, RAB11 family interacting protein 2 (class I), rab11 family-interacting protein 2, Rab11-FIP2NRip11
Gene Symbols RAB11FIP2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to RAB11FIP2 (RAB11 family interacting protein 2 (class I)) The peptide sequence was selected from the N terminal of RAB11FIP2. Peptide sequence LLIQGSPEKYILFLIVMHRSLVGLDKFLGQVAINLNDIFEDKQRRKTEWF.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 22841
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.