Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RAB11FIP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | RAB11FIP2 |
---|---|
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Regulatory Status | RUO |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP157009
![]() |
Novus Biologicals
NBP157009 |
100 μL |
Each for $499.50
|
|
|||||
NBP15700920
![]() |
Novus Biologicals
NBP15700920UL |
20 μL | N/A | N/A | N/A | ||||
Description
RAB11FIP2 Polyclonal specifically detects RAB11FIP2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
RAB11FIP2 | |
Unconjugated | |
RUO | |
KIAA0941RAB11-FIP2 long isoform, nRip11, RAB11 family interacting protein 2 (class I), rab11 family-interacting protein 2, Rab11-FIP2NRip11 | |
RAB11FIP2 | |
IgG |
Polyclonal | |
Rabbit | |
Q7L804 | |
22841 | |
Synthetic peptides corresponding to RAB11FIP2 (RAB11 family interacting protein 2 (class I)) The peptide sequence was selected from the N terminal of RAB11FIP2. Peptide sequence LLIQGSPEKYILFLIVMHRSLVGLDKFLGQVAINLNDIFEDKQRRKTEWF. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title