RAB23 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179647

Catalog No. NBP179647

Description

RAB23 Polyclonal specifically detects RAB23 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: RAB23
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp781H0695, HSPC137, MGC8900, RAB family small GTP binding protein RAB 23, RAB23, member RAS oncogene family, ras-related protein Rab-23
• Host Species: Rabbit
• Molecular Weight of Antigen: 26 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Zebrafish: 79%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_033025
• Gene Symbols: RAB23
• Immunogen: Synthetic peptide directed towards the middle region of human Rab23The immunogen for this antibody is Rab23. Peptide sequence DPEQTHSSSNKIGVFNASVRSHLGQNSSSLNGGDVINLRPNKQRTKRTRN.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51715
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.