Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. RAB27B Antibody, Novus Biologicals™

RAB27B Antibody, Novus Biologicals™
SDP

Catalog No. NBP1796320 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP1796320 20 μL
NBP179631 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP1796320 Supplier Novus Biologicals Supplier No. NBP17963120UL

Description

Rabbit Polyclonal Antibody

RAB27B Polyclonal specifically detects RAB27B in Human, Mouse samples. It is validated for Western Blot.

Specifications

Antigen RAB27B
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_085031
Gene Alias C25KG, RAB27B, member RAS oncogene family, ras-related protein Rab-27B
Gene Symbols RAB27B
Host Species Rabbit
Immunogen The immunogen for this antibody is Rab27b. Peptide sequence YCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVE.
Molecular Weight of Antigen 24 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5874
Target Species Human, Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.