Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RAB35 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17948420UL
Description
RAB35 Polyclonal specifically detects RAB35 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
RAB35 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_006852 | |
RAB35 | |
Synthetic peptide directed towards the middle region of human RAB35. Peptide sequence: GIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTK | |
Affinity Purified | |
RUO | |
11021 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
GTP-binding protein RAY, H-ray, RAB1C, RAB35, member RAS oncogene family, Ras-related protein Rab-1C, ras-related protein rab-1c (GTP-binding protein ray), ras-related protein Rab-35, RAY | |
Rabbit | |
23 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction