Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RAB35 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | RAB35 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17948420
|
Novus Biologicals
NBP17948420UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP179484
|
Novus Biologicals
NBP179484 |
100 μL |
Each for $487.50
|
|
|||||
Description
RAB35 Polyclonal specifically detects RAB35 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| RAB35 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| GTP-binding protein RAY, H-ray, RAB1C, RAB35, member RAS oncogene family, Ras-related protein Rab-1C, ras-related protein rab-1c (GTP-binding protein ray), ras-related protein Rab-35, RAY | |
| RAB35 | |
| IgG | |
| 23 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_006852 | |
| 11021 | |
| Synthetic peptide directed towards the middle region of human RAB35. Peptide sequence: GIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTK | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title