Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RAB38 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15893020UL
Description
RAB38 Polyclonal specifically detects RAB38 in Human samples. It is validated for Western Blot.Specifications
RAB38 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
P57729 | |
RAB38 | |
Synthetic peptides corresponding to RAB38(RAB38, member RAS oncogene family) The peptide sequence was selected from the N terminal of RAB38. Peptide sequence MQAPHKEHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKV. | |
20 μL | |
Signal Transduction | |
23682 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
Melanoma antigen NY-MEL-1, NY-MEL-1, RAB38, member RAS oncogene family, Rab-related GTP-binding protein, ras-related protein Rab-38, rrGTPbp | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction