Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RAB38 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	RAB38
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15893020 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP15893020UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP158930 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP158930	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

RAB38 Polyclonal specifically detects RAB38 in Human samples. It is validated for Western Blot.

Specifications

Antigen	RAB38
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Signal Transduction
Gene Alias	Melanoma antigen NY-MEL-1, NY-MEL-1, RAB38, member RAS oncogene family, Rab-related GTP-binding protein, ras-related protein Rab-38, rrGTPbp
Gene Symbols	RAB38
Isotype	IgG

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	P57729
Gene ID (Entrez)	23682
Immunogen	Synthetic peptides corresponding to RAB38(RAB38, member RAS oncogene family) The peptide sequence was selected from the N terminal of RAB38. Peptide sequence MQAPHKEHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKV.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

RAB38 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents