Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. RAB3IP Antibody, Novus Biologicals™

RAB3IP Antibody, Novus Biologicals™
SDP

Catalog No. NBP15674520 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15674520 20 μL
NBP156745 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15674520 Supplier Novus Biologicals Supplier No. NBP15674520UL

Description

Rabbit Polyclonal Antibody

RAB3IP Polyclonal specifically detects RAB3IP in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen RAB3IP
Applications Western Blot, Immunohistochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000, Immunohistochemistry
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q96QF0
Gene Alias FLJ14660, FLJ22548, MGC71495, RAB3A interacting protein (rabin3), rab-3A-interacting protein, Rab3A-interacting protein, rabin-3, RABIN3, SSX2 interacting protein, SSX2-interacting protein
Gene Symbols RAB3IP
Host Species Rabbit
Immunogen Synthetic peptides corresponding to RAB3IP(RAB3A interacting protein (rabin3)) The peptide sequence was selected from the N terminal of RAB3IP. Peptide sequence APCSTSGVTAGLTKLTTRKDNYNAEREFLQGATITEACDGSDDIFGLSTD.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 117177
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.