RAB40B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158922

Catalog No. NBP158922

Description

RAB40B Polyclonal specifically detects RAB40B in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RAB40B
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: GTP-binding protein homologous to Saccharomyces cerevisiae SEC4, Protein Rar, RAB40B, member RAS oncogene family, RAR, ras-related protein Rab-40B, SEC4LFLJ42385, SOCS box-containing protein RAR
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Xenopus: 100%; Chicken: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%; Bovine: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q12829
• Gene Symbols: RAB40B
• Immunogen: Synthetic peptides corresponding to RAB40B(RAB40B, member RAS oncogene family) The peptide sequence was selected from the middle region of RAB40B. Peptide sequence YAERLGVTFFEVSPLCNFNITESFTELARIVLLRHGMDRLWRPSKVLSLQ.
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 10966
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.