Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RAB40B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15892220UL
Description
RAB40B Polyclonal specifically detects RAB40B in Human samples. It is validated for Western Blot.Specifications
RAB40B | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q12829 | |
RAB40B | |
Synthetic peptides corresponding to RAB40B(RAB40B, member RAS oncogene family) The peptide sequence was selected from the middle region of RAB40B. Peptide sequence YAERLGVTFFEVSPLCNFNITESFTELARIVLLRHGMDRLWRPSKVLSLQ. | |
20 μL | |
Signal Transduction | |
10966 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
GTP-binding protein homologous to Saccharomyces cerevisiae SEC4, Protein Rar, RAB40B, member RAS oncogene family, RAR, ras-related protein Rab-40B, SEC4LFLJ42385, SOCS box-containing protein RAR | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction