Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP158880

Rab5a Antibody, Novus Biologicals™
SDP

Catalog No. NBP158880 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP158880 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP158880 Supplier Novus Biologicals Supplier No. NBP158880
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Rab5a Polyclonal specifically detects Rab5a in Human, Mouse, Mammal, Zebrafish samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Rab5a
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10 - 1:500, Immunocytochemistry/Immunofluorescence 1:10 - 1:500, Immunohistochemistry-Paraffin 1:10 - 1:500
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P20339
Gene Alias RAB5A, member RAS oncogene family, RAB5RAS-associated protein RAB5A, ras-related protein Rab-5A
Gene Symbols RAB5A
Host Species Rabbit
Immunogen Synthetic peptides corresponding to RAB5A(RAB5A, member RAS oncogene family). The peptide sequence was selected from the middle region of RAB5A. Peptide sequence KTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCS.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Endosome Markers, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 5868
Test Specificity Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Bovine: 92%; Chicken: 85%; Pig: 78%; Sheep: 78%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Mammalia, Zebrafish, Canine, Equine, Guinea Pig, Rabbit, Sheep
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.