RAB6C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP174265

Catalog No. NBP174265

Description

RAB6C Polyclonal specifically detects RAB6C in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RAB6C
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: RAB6C, member RAS oncogene family, ras-related protein Rab-6C, WTH3Rab6-like protein WTH3
• Host Species: Rabbit
• Molecular Weight of Antigen: 28 kDa
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 84084
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9H0N0
• Gene Symbols: RAB6C
• Immunogen: Synthetic peptides corresponding to the middle region of RAB6C. Immunizing peptide sequence DVIITLVGNRTDLADKRQVSVEEGERKAKGLNVTFIETRAKAGYNVKQLF.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Goat: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Yeast, Zebrafish
• Isotype: IgG