Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RAB6C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17426520UL
Description
RAB6C Polyclonal specifically detects RAB6C in Human samples. It is validated for Western Blot.Specifications
RAB6C | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q9H0N0 | |
RAB6C | |
Synthetic peptides corresponding to the middle region of RAB6C. Immunizing peptide sequence DVIITLVGNRTDLADKRQVSVEEGERKAKGLNVTFIETRAKAGYNVKQLF. | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
RAB6C, member RAS oncogene family, ras-related protein Rab-6C, WTH3Rab6-like protein WTH3 | |
Rabbit | |
28 kDa | |
20 μL | |
Signal Transduction | |
84084 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction