Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RAB6C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	RAB6C
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP17426520 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP17426520UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP174265 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP174265	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

RAB6C Polyclonal specifically detects RAB6C in Human samples. It is validated for Western Blot.

Specifications

Antigen	RAB6C
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Signal Transduction
Gene Alias	RAB6C, member RAS oncogene family, ras-related protein Rab-6C, WTH3Rab6-like protein WTH3
Gene Symbols	RAB6C
Isotype	IgG
Molecular Weight of Antigen	28 kDa

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	Q9H0N0
Gene ID (Entrez)	84084
Immunogen	Synthetic peptides corresponding to the middle region of RAB6C. Immunizing peptide sequence DVIITLVGNRTDLADKRQVSVEEGERKAKGLNVTFIETRAKAGYNVKQLF.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

RAB6C Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents