Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RAB8B Antibody, Novus Biologicals™
SDP

Catalog No. NBP16897420 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16897420 20 μL
NBP168974 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP16897420 Supplier Novus Biologicals Supplier No. NBP16897420UL

Rabbit Polyclonal Antibody

RAB8B Polyclonal specifically detects RAB8B in Human samples. It is validated for Western Blot.

Specifications

Antigen RAB8B
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q92930
Gene Alias FLJ38125, RAB-8b protein, RAB8B, member RAS oncogene family, ras-related protein Rab-8B
Gene Symbols RAB8B
Host Species Rabbit
Immunogen Synthetic peptides corresponding to RAB8B (RAB8B, member RAS oncogene family) The peptide sequence was selected from the C terminal of RAB8B. Peptide sequence RNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAK.
Molecular Weight of Antigen 78 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 51762
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.