Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Calcium-sensing R/CaSR Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP238622

 View more versions of this product

Catalog No. NBP238622


Only null left
Add to Cart

Description

Description

Calcium-sensing R/CaSR Polyclonal specifically detects Calcium-sensing R/CaSR in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.
Specifications

Specifications

Calcium-sensing R/CaSR
Polyclonal
Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
P41180
CASR
This antibody was developed against a recombinant protein corresponding to amino acids: ADDDYGRPGIEKFREEAEERDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWASSSLI
0.1 mL
Cytoskeleton Markers, Extracellular Matrix, GPCR, Growth and Development, Lipid and Metabolism, Neuroscience, Neurotransmission, Signal Transduction
846
Human, Mouse
IgG
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
calcium-sensing receptor, CAR, CaSR, EIG8, extracellular calcium-sensing receptor, FHH, FIH, GPRC2AHHC, HHC1, hypocalciuric hypercalcemia 1, NSHPT, parathyroid Ca(2+)-sensing receptor 1, Parathyroid cell calcium-sensing receptor, PCaR1, PCAR1MGC138441
Rabbit
Affinity Purified
RUO
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.