Rabbit anti-SIRT7, Polyclonal Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP247276

Catalog No. NBP247276

Description

SIRT7 Polyclonal specifically detects SIRT7 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SIRT7
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: EC 3.5.1.-, MGC126840, MGC126842, silent mating type information regulation 2, S.cerevisiae, homolog 7, SIR2L7NAD-dependent deacetylase sirtuin-7, SIR2-like protein 7, sir2-related protein type 7, sirtuin (silent mating type information regulation 2 homolog) 7 (S. cerevisiae), sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 7, sirtuin 7, sirtuin type 7
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SIRT7
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TPKDDWAALKLHGKCDDVMRLLMAELGLEIPAYSRWQDPIFSLATPLRAGEEGSHSRKSLCRSREEAPPGDRGAPLSSAPILGGWFGRGCTKRTK
• Quantity: 0.1 mL
• Research Discipline: DNA Repair, Epigenetics, Histone Deacetylases
• Gene ID (Entrez): 51547
• Target Species: Human
• Isotype: IgG

For Research Use Only