RABL4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP325088

Catalog No. NB301364

Description

RABL4 Polyclonal antibody specifically detects RABL4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: RABL4
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: intraflagellar transport 27 homolog (Chlamydomonas), intraflagellar transport protein 27 homolog, member of RAS oncogene family-like 4, Putative GTP-binding protein RAY-like, RABL4, Rab-like protein 4
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein RABL4 using the following amino acid sequence: MVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKSYTLTTGMDLVVKTVPVPDTGDSVELFIFDSAGKELFSEMLDKLWESPNVLCLVYDV
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 11020
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified