Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RAD54L Antibody, Novus Biologicals™
SDP

Catalog No. NBP233916 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP233916 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP233916 Supplier Novus Biologicals Supplier No. NBP233916
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody has been used in 2 publications

RAD54L Polyclonal specifically detects RAD54L in Human, Mouse samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen RAD54L
Applications Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04 - 0.4 ug/mL, Simple Western, Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL
Formulation PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q92698
Gene Alias EC 3.6.1, hHR54EC 3.6.4.-, HR54, hRAD54HRAD54, RAD54 (S.cerevisiae)-like, RAD54 homolog, RAD54ADNA repair and recombination protein RAD54-like, RAD54-like (S. cerevisiae)
Gene Symbols RAD54L
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: TLMWTLLRQSPECKPEIDKAVVVSPSSLVKNWYNEVGKWLGGRIQPLAIDGGSKDEIDQKLEGFMNQRGARVSSPILIISYETFRLHVGVLQKGSVGLVICDEGHRLKNSENQTYQALDSLNTSRRVLISGTPIQNDLLEYFSLV
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline DNA Repair, Homologous Recombination
Primary or Secondary Primary
Gene ID (Entrez) 8438
Test Specificity Specificity of human RAD54L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.