Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RAD9B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP158205
Description
RAD9B Polyclonal specifically detects RAD9B in Human samples. It is validated for Western Blot.Specifications
RAD9B | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
cell cycle checkpoint control protein RAD9B, cell cycle checkpoint control protein RAD9B homolog, DNA repair exonuclease rad9 homolog B, FLJ40346, hRAD9B, MGC75426, RAD9 homolog B (S. pombe) | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Expected identity based on immunogen sequence: Human: 100%; Pig: 100%; Canine: 92%; Equine: 78%. | |
Human, Rat, Pig, Canine, Equine | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q6WBX8-3 | |
RAD9B | |
Synthetic peptides corresponding to RAD9B(RAD9 homolog B (S. cerevisiae)) The peptide sequence was selected from the middle region of RAD9B. Peptide sequence SSVSNTEEVPGSLCLRKFSCMFFGAVSSDQQEHFNHPFDSLARASDSEED. | |
100 μL | |
Cell Cycle and Replication | |
144715 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction