Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RAD9B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	RAD9B
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP158205 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP158205	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

RAD9B Polyclonal specifically detects RAD9B in Human samples. It is validated for Western Blot.

Specifications

Antigen	RAD9B
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Cell Cycle and Replication
Gene Alias	cell cycle checkpoint control protein RAD9B, cell cycle checkpoint control protein RAD9B homolog, DNA repair exonuclease rad9 homolog B, FLJ40346, hRAD9B, MGC75426, RAD9 homolog B (S. pombe)
Gene Symbols	RAD9B
Isotype	IgG

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	Q6WBX8-3
Gene ID (Entrez)	144715
Immunogen	Synthetic peptides corresponding to RAD9B(RAD9 homolog B (S. cerevisiae)) The peptide sequence was selected from the middle region of RAD9B. Peptide sequence SSVSNTEEVPGSLCLRKFSCMFFGAVSSDQQEHFNHPFDSLARASDSEED.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

RAD9B Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents