Learn More
Description
Specifications
Specifications
| Antigen | RAE1 |
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 1-4 μg/mL |
| Formulation | PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | dJ481F12.3, dJ800J21.1, FLJ30608, homolog of yeast Rae1 (Bharathi) mRNA-associated protein of 41 kDa (Kraemer), MGC117333, MGC126076, MGC126077, MIG14, migration-inducing gene 14, Mnrp41, mRNA export factor, mRNA export protein, mRNA-associated protein mrnp 41, mRNA-binding protein, 41-kD, MRNP41, RAE1 (RNA export 1, S.pombe) homolog, Rae1 protein homolog, RAE1 RNA export 1 homolog (S. pombe) |
| Gene Symbols | RAE1 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
